Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla Olfactory receptor 1G1 (OR1G1)

This Recombinant Gorilla gorilla gorilla Olfactory receptor 1G1 (OR1G1) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 1G1

UniProt

Q9TU86

Expression Region

1-313

Origin

Gorilla gorilla gorilla (Lowland gorilla)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGKNLTSISEFFLLGFSEQLEEQKALFGSFLFMYLVTVAGNLLIILVIITDTQLHTPMY FFLANLSLADACFVSTTVPKMLANIQIQSQAISYSGCLLQLYFFMLFVMLEAFLLAVMAY DRYVAICHPLHYILIMSPGLCVFLVSASWIMNALHSLLHTLLMNSLSFCANHEIPHFFCD IDPLLSLSCTDPFTNELVIFITGGLTGLVCVLCLIISYTNIFSTILKIPSAQGKRKAFST CGSHLSVVSLFFGTSFCVYFIPPSTRSAQKDTVASVMYTVVTPMLNPFIYSLRNQEIKSS LRKLIWVREIHSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
BNC040679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL
BNC680040-500 1x 500 µL

CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF405S conjugate, 0.1mg/mL
BNC040851-100 1x 100 µL

HSP60 (LK1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL
BNC470043-500 1x 500 µL

P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker) (rGPC3/863), CF640R conjugate, 0.1mg/mL
BNC401846-500 1x 500 µL

Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker) (rGPC3/863), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin Receptor (B6.2), CF647 conjugate, 0.1mg/mL
BNC470741-500 1x 500 µL

Prolactin Receptor (B6.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details