Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus Olfactory receptor 1D2 (OR1D2)

This Recombinant Pongo pygmaeus Olfactory receptor 1D2 (OR1D2) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 1D2

UniProt

Q9TU84

Expression Region

1-313

Origin

Pongo pygmaeus (Bornean orangutan)

Field of Research

Neuroscience; Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGGNQSEGSEFLLLGMSESPEQQRILFWMFLSMYLVTVLGNVLIILAISSDSRLHTPMY FFLANLSFTDLFFVTNTIPKMLVNLQSQDKAISYAGCLTQLYFLLSLVTLDNLILAVMAY DRYVAICCPLHYVTAMSPRLCILLLSLCWVFSVLYGLIHTLLMTRVTFCGSRKIHYLFCE MYFLLRLACSNIQINHTVLXATGCFIFLIPLGFMIXSYARIVRAILRIPSATGKYKAFST CASHLAVVSLFYGTLGMVYLQPLQTYSTKDSVATVMYAVVTPMMNPFIYSLRNKDIHGAL GRLLQGKAFQKLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arachidic Acid Chloride
TRC-A319410-250MG 250 mg

Arachidic Acid Chloride

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/11), CF640R conjugate, 0.1mg/mL
BNC400011-500 1x 500 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZCWPW2 (NM_001040432) Human Over-expression Lysate
LY421752 100 µg

ZCWPW2 (NM_001040432) Human Over-expression Lysate

Sign In for Pricing
View Details
3-Phenanthrenecarboxylic Acid
TRC-P294805-1G 1 g

3-Phenanthrenecarboxylic Acid

Sign In for Pricing
View Details
IL12RB2 (NM_001559) Human Over-expression Lysate
LY400597 100 µg

IL12RB2 (NM_001559) Human Over-expression Lysate

Sign In for Pricing
View Details
PPIC (NM_000943) Human Over-expression Lysate
LC424438 20 µg

PPIC (NM_000943) Human Over-expression Lysate

Sign In for Pricing
View Details