Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus Olfactory receptor 1D2 (OR1D2)

This Recombinant Pongo pygmaeus Olfactory receptor 1D2 (OR1D2) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 1D2

UniProt

Q9TU84

Expression Region

1-313

Origin

Pongo pygmaeus (Bornean orangutan)

Field of Research

Neuroscience; Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGGNQSEGSEFLLLGMSESPEQQRILFWMFLSMYLVTVLGNVLIILAISSDSRLHTPMY FFLANLSFTDLFFVTNTIPKMLVNLQSQDKAISYAGCLTQLYFLLSLVTLDNLILAVMAY DRYVAICCPLHYVTAMSPRLCILLLSLCWVFSVLYGLIHTLLMTRVTFCGSRKIHYLFCE MYFLLRLACSNIQINHTVLXATGCFIFLIPLGFMIXSYARIVRAILRIPSATGKYKAFST CASHLAVVSLFYGTLGMVYLQPLQTYSTKDSVATVMYAVVTPMMNPFIYSLRNKDIHGAL GRLLQGKAFQKLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM67 (NM_001004342) Human Over-expression Lysate
LY423736 100 µg

TRIM67 (NM_001004342) Human Over-expression Lysate

Sign In for Pricing
View Details
Ammonium Oxalate
TRC-A634130-5G 5 g

Ammonium Oxalate

Sign In for Pricing
View Details
BCL2 Mouse Monoclonal Antibody [Clone ID: 100/D5+124]
AM50201PU-T 20 µg

BCL2 Mouse Monoclonal Antibody [Clone ID: 100/D5+124]

Sign In for Pricing
View Details
Nesprin3 (SYNE3) Human Knockdown Lysate
LY300495 100 µg

Nesprin3 (SYNE3) Human Knockdown Lysate

Sign In for Pricing
View Details
Pcsk9 Mouse Gene Knockout Kit (CRISPR)
KN312980LP 1 Kit

Pcsk9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SLC16A5 Rabbit Polyclonal Antibody
TA392677 100 µL

SLC16A5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details