Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 56A5 (OR56A5)

This Recombinant Human Olfactory receptor 56A5 (OR56A5) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 56A5

UniProt

P0C7T3

Expression Region

1-313

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLPSNNSTSPVFEFFLICFPSFQSWQHWLSLPLSLLFLLAMGANATLLITIYLEASLHQ PLYYLLSLLSLLDIVLCLTVIPKVLAIFWFDLRSISFPACFLQVFIMNSFLTMESCTFMI MAYDRYVAICKPLQYSSIITDQFVARAAIFVVARNGLLTMPIPILSSRLRYCAGHIIKNC ICTNVSVSKLSCDDITLNQSYQFVIGWTLLGSDLILIVLSYFFILKTVLRIKGEGDMAKA LGTCGSHFILILFFTTVLLVLVITNLARKRIPPDVPILLNILHHLIPPALNPIVYGVRTK EIKQGIQNLLRRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Endometrium
CS702064 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
MAD2L2 (NM_001127325) Human Recombinant Protein
TP325253M 100 µg

MAD2L2 (NM_001127325) Human Recombinant Protein

Sign In for Pricing
View Details
Beta Catenin Mouse Monoclonal Antibody [10-C0-B7]
M1405-6 100 µL

Beta Catenin Mouse Monoclonal Antibody [10-C0-B7]

Sign In for Pricing
View Details
Progesterone (6-5E-3F), CF647 conjugate, 0.1mg/mL
BNC470236-100 1x 100 µL

Progesterone (6-5E-3F), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS702818 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
CCDC85C (NM_001144995) Human Over-expression Lysate
LC428630 20 µg

CCDC85C (NM_001144995) Human Over-expression Lysate

Sign In for Pricing
View Details