Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 56A5 (OR56A5)

This Recombinant Human Olfactory receptor 56A5 (OR56A5) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 56A5

UniProt

P0C7T3

Expression Region

1-313

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLPSNNSTSPVFEFFLICFPSFQSWQHWLSLPLSLLFLLAMGANATLLITIYLEASLHQ PLYYLLSLLSLLDIVLCLTVIPKVLAIFWFDLRSISFPACFLQVFIMNSFLTMESCTFMI MAYDRYVAICKPLQYSSIITDQFVARAAIFVVARNGLLTMPIPILSSRLRYCAGHIIKNC ICTNVSVSKLSCDDITLNQSYQFVIGWTLLGSDLILIVLSYFFILKTVLRIKGEGDMAKA LGTCGSHFILILFFTTVLLVLVITNLARKRIPPDVPILLNILHHLIPPALNPIVYGVRTK EIKQGIQNLLRRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Kidney
CS509773 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
TIF1 alpha (TRIM24) Human Knockdown Lysate
LY300456 100 µg

TIF1 alpha (TRIM24) Human Knockdown Lysate

Sign In for Pricing
View Details
IFluor® 647-Concanavalin A Conjugate
25595-AAT 1 mg

IFluor® 647-Concanavalin A Conjugate

Sign In for Pricing
View Details
Frozen Tissue Sections, Cecum
CS639140 5x 5 µm

Frozen Tissue Sections, Cecum

Sign In for Pricing
View Details
CD34 (Hematopoietic Stem Cell & Endothelial Marker) (N/A), CF740 conjugate, 0.1mg/mL
BNC741807-100 1x 100 µL

CD34 (Hematopoietic Stem Cell & Endothelial Marker) (N/A), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLEKHH2 (C-term) Rabbit Polyclonal Antibody
AP53317PU-N 400 µL

PLEKHH2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details