Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1G1 (OR1G1)

This Recombinant Human Olfactory receptor 1G1 (OR1G1) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 1G1, Olfactory receptor 17-209, OR17-209, Olfactory receptor 1G2, Olfactory receptor OR17-8

UniProt

P47890

Expression Region

1-313

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGKNLTSISECFLLGFSEQLEEQKPLFGSFLFMYLVTVAGNLLIILVIITDTQLHTPMY FFLANLSLADACFVSTTVPKMLANIQIQSQAISYSGCLLQLYFFMLFVMLEAFLLAVMAY DCYVAICHPLHYILIMSPGLCIFLVSASWIMNALHSLLHTLLMNSLSFCANHEIPHFFCD INPLLSLSCTDPFTNELVIFITGGLTGLICVLCLIISYTNVFSTILKIPSAQGKRKAFST CSSHLSVVSLFFGTSFCVDFSSPSTHSAQKDTVASVMYTVVTPMLNPFIYSLRNQEIKSS LRKLIWVRKIHSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gamma-Lipoic Acid
TRC-L468755-5G 5 g

Gamma-Lipoic Acid

Sign In for Pricing
View Details
Dylight 350 Conjugated Ulex europaeus Lectin (Gorse, Furze) -UEA-I-
DY350-2201-1 1 mg

Dylight 350 Conjugated Ulex europaeus Lectin (Gorse, Furze) -UEA-I-

Sign In for Pricing
View Details
GPCR 2037 (GPR151) Mouse Monoclonal Antibody [Clone ID: OTI2B4]
CF811788 100 µg

GPCR 2037 (GPR151) Mouse Monoclonal Antibody [Clone ID: OTI2B4]

Sign In for Pricing
View Details
Antigen-Down HRP Conjugate Stabilizer, 5X
6102 100 mL

Antigen-Down HRP Conjugate Stabilizer, 5X

Sign In for Pricing
View Details
Triheneicosanoin
TRC-T265360-250MG 250 mg

Triheneicosanoin

Sign In for Pricing
View Details
Repulsive Guidance Molecule C (HFE2) Mouse Monoclonal Antibody [Clone ID: OTI3H2]
CF809327 100 µg

Repulsive Guidance Molecule C (HFE2) Mouse Monoclonal Antibody [Clone ID: OTI3H2]

Sign In for Pricing
View Details