Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1G1 (OR1G1)

This Recombinant Human Olfactory receptor 1G1 (OR1G1) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 1G1, Olfactory receptor 17-209, OR17-209, Olfactory receptor 1G2, Olfactory receptor OR17-8

UniProt

P47890

Expression Region

1-313

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGKNLTSISECFLLGFSEQLEEQKPLFGSFLFMYLVTVAGNLLIILVIITDTQLHTPMY FFLANLSLADACFVSTTVPKMLANIQIQSQAISYSGCLLQLYFFMLFVMLEAFLLAVMAY DCYVAICHPLHYILIMSPGLCIFLVSASWIMNALHSLLHTLLMNSLSFCANHEIPHFFCD INPLLSLSCTDPFTNELVIFITGGLTGLICVLCLIISYTNVFSTILKIPSAQGKRKAFST CSSHLSVVSLFFGTSFCVDFSSPSTHSAQKDTVASVMYTVVTPMLNPFIYSLRNQEIKSS LRKLIWVRKIHSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H4C13 (NM_003546) Human Recombinant Protein
TP760389 50 µg

H4C13 (NM_003546) Human Recombinant Protein

Sign In for Pricing
View Details
APC Anti-Mouse/Human CD11b Antibody[M1/70]
E-AB-F1081E-01 50 Tests

APC Anti-Mouse/Human CD11b Antibody[M1/70]

Sign In for Pricing
View Details
APC Anti-Mouse/Human CD11b Antibody[M1/70]
E-AB-F1081E-02 100 Tests

APC Anti-Mouse/Human CD11b Antibody[M1/70]

Sign In for Pricing
View Details
APC Anti-Mouse/Human CD11b Antibody[M1/70]
E-AB-F1081E-03 2x 100 Tests

APC Anti-Mouse/Human CD11b Antibody[M1/70]

Sign In for Pricing
View Details
ZZEF1 Human Gene Knockout Kit (CRISPR)
KN420993 1 Kit

ZZEF1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Neurofilament (NF-H) (Neuronal Marker) (NEFL.H/2324R), 1mg/mL
BNUM2324-50 1x 50 µL

Neurofilament (NF-H) (Neuronal Marker) (NEFL.H/2324R), 1mg/mL

Sign In for Pricing
View Details