Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative olfactory receptor 2B3 (OR2B3)

This Recombinant Human Putative olfactory receptor 2B3 (OR2B3) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Putative olfactory receptor 2B3, Hs6M1-1, Olfactory receptor OR6-14, OR6-4, Olfactory receptor 6-4

UniProt

O76000

Expression Region

1-313

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNWENESSPKEFILLGFSDRAWLQMPLFVVLLISYTITIFGNVSIMMVCILDPKLHTPMY FFLTNLSILDLCYTTTTVPHMLVNIGCNKKTISYAGCVAHLIIFLALGATECLLLAVMSF DRYVAVCRPLHYVVIMNYWFCLRMAAFSWLIGFGNSVLQSSLTLNMPRCGHQEVDHFFCE VPALLKLSCADTKPIEAELFFFSVLILLIPVTLILISYGFIAQAVLKIRSAEGRQKAFGT CGSHMIVVSLFYGTAIYMYLQPPSSTSKDWGKMVSLFYGIITSMLNSLIYSLRNKDMKEA FKRLMPRIFFCKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OLFM4 (Olfactomedin 4) ELISA Kit
EH3477 96 Tests

Human OLFM4 (Olfactomedin 4) ELISA Kit

Sign In for Pricing
View Details
Human ZFC3H1 qPCR Primer Pair
QH67493S 200 Tests

Human ZFC3H1 qPCR Primer Pair

Sign In for Pricing
View Details
Mouse Monoclonal NAP1L1 Antibody (2A9)
H00004673-M01 0.1 mg

Mouse Monoclonal NAP1L1 Antibody (2A9)

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD335 Antibody
RD30351F-01 50 Tests

PerCP/Cyanine5.5 Anti-Mouse CD335 Antibody

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD335 Antibody
RD30351F-02 100 Tests

PerCP/Cyanine5.5 Anti-Mouse CD335 Antibody

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD335 Antibody
RD30351F-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Mouse CD335 Antibody

Sign In for Pricing
View Details