Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative olfactory receptor 2B3 (OR2B3)

This Recombinant Human Putative olfactory receptor 2B3 (OR2B3) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Putative olfactory receptor 2B3, Hs6M1-1, Olfactory receptor OR6-14, OR6-4, Olfactory receptor 6-4

UniProt

O76000

Expression Region

1-313

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNWENESSPKEFILLGFSDRAWLQMPLFVVLLISYTITIFGNVSIMMVCILDPKLHTPMY FFLTNLSILDLCYTTTTVPHMLVNIGCNKKTISYAGCVAHLIIFLALGATECLLLAVMSF DRYVAVCRPLHYVVIMNYWFCLRMAAFSWLIGFGNSVLQSSLTLNMPRCGHQEVDHFFCE VPALLKLSCADTKPIEAELFFFSVLILLIPVTLILISYGFIAQAVLKIRSAEGRQKAFGT CGSHMIVVSLFYGTAIYMYLQPPSSTSKDWGKMVSLFYGIITSMLNSLIYSLRNKDMKEA FKRLMPRIFFCKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-[ (3-Bromobenzyl) oxy]-5-chlorobenzoic acid
sc-321217 500 mg

2-[ (3-Bromobenzyl) oxy]-5-chlorobenzoic acid

Sign In for Pricing
View Details
Rabbit Polyclonal RPC62 Antibody [DyLight 594]
NBP1-71821DL594 0.1 mL

Rabbit Polyclonal RPC62 Antibody [DyLight 594]

Sign In for Pricing
View Details
NOSIP Adenovirus (Mouse)
32011055 1.0 mL

NOSIP Adenovirus (Mouse)

Sign In for Pricing
View Details
CCL17 Conjugated Antibody
MBS9442342-01 0.1 mL (Biotin)

CCL17 Conjugated Antibody

Sign In for Pricing
View Details
CCL17 Conjugated Antibody
MBS9442342-02 0.1 mL (AF350)

CCL17 Conjugated Antibody

Sign In for Pricing
View Details
CCL17 Conjugated Antibody
MBS9442342-03 0.1 mL (AF405)

CCL17 Conjugated Antibody

Sign In for Pricing
View Details