Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 143 (Olfr143)

This Recombinant Mouse Olfactory receptor 143 (Olfr143) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 143, Odorant receptor K18, Olfactory receptor 170-6, Olfactory receptor 7A

UniProt

P34985

Expression Region

1-313

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMQITMENKSSVSEFILMGLTDQPELQLPLFVLFLMNYTATVMGNLTLMNLICLNSNLHT PMYFFLFNLSFIDFCYSMVFTPKMLMSFILEKNTISFGGCMAQLFFFLFFVNSESYVLTA MAYDRYVAICKPLTYKVIMSPKICCLLIFSSYLMGFASAMAHTGCMIRLSFCDSNIINHY MCDIFPLLPLSCSSTYVNELMSSVVVGSAIILCCLIILISYAMILFNIIHMSSGKGWSKA LGTCGSHIITVSLFYGSGLLAYVKPSSAKTVGQGKFFSVFYTLLVPMLNPLIYSLRNKDV KLAVKKTWKRITS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-(Diethylamino)butylamine
TRC-D443575-250MG 250 mg

4-(Diethylamino)butylamine

Sign In for Pricing
View Details
Ulex Europaeus Agglutinin I (UEA I), CF®568 Conjugate
#29110 1x 1 mL

Ulex Europaeus Agglutinin I (UEA I), CF®568 Conjugate

Sign In for Pricing
View Details
BCL2 Mouse Monoclonal Antibody [Clone ID: SPM530]
AM50164PU-S 100 µg

BCL2 Mouse Monoclonal Antibody [Clone ID: SPM530]

Sign In for Pricing
View Details
Beclin 1 (BECN1) Human Gene Knockout Kit (CRISPR)
KN401629 1 Kit

Beclin 1 (BECN1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Polystyrene A FP
HA40045007.100G 100 g

Polystyrene A FP

Sign In for Pricing
View Details
Cell Meter™ Annexin V Binding Apoptosis Assay Kit *Deep Red Fluorescence Optimized for Flow Cytometry*
22827-AAT 100 Tests

Cell Meter™ Annexin V Binding Apoptosis Assay Kit *Deep Red Fluorescence Optimized for Flow Cytometry*

Sign In for Pricing
View Details