Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 143 (Olfr143)

This Recombinant Mouse Olfactory receptor 143 (Olfr143) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 143, Odorant receptor K18, Olfactory receptor 170-6, Olfactory receptor 7A

UniProt

P34985

Expression Region

1-313

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMQITMENKSSVSEFILMGLTDQPELQLPLFVLFLMNYTATVMGNLTLMNLICLNSNLHT PMYFFLFNLSFIDFCYSMVFTPKMLMSFILEKNTISFGGCMAQLFFFLFFVNSESYVLTA MAYDRYVAICKPLTYKVIMSPKICCLLIFSSYLMGFASAMAHTGCMIRLSFCDSNIINHY MCDIFPLLPLSCSSTYVNELMSSVVVGSAIILCCLIILISYAMILFNIIHMSSGKGWSKA LGTCGSHIITVSLFYGSGLLAYVKPSSAKTVGQGKFFSVFYTLLVPMLNPLIYSLRNKDV KLAVKKTWKRITS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPEF2 Antibody
KC-3889-01 50 μL

SPEF2 Antibody

Sign In for Pricing
View Details
SPEF2 Antibody
KC-3889-02 100 µL

SPEF2 Antibody

Sign In for Pricing
View Details
SPEF2 Antibody
KC-3889-03 1 mL

SPEF2 Antibody

Sign In for Pricing
View Details
Bcl-2 (100/D5 + 124), CF405S conjugate, 0.1mg/mL
BNC041234-500 1x 500 µL

Bcl-2 (100/D5 + 124), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tide Quencher™ 1 phosphoramidite [TQ1 phosphoramidite]
2198-AAT 100 µmole

Tide Quencher™ 1 phosphoramidite [TQ1 phosphoramidite]

Sign In for Pricing
View Details
SEMA6C Antibody
KC-7597-01 50 μL

SEMA6C Antibody

Sign In for Pricing
View Details