Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1C1 (OR1C1)

This Recombinant Human Olfactory receptor 1C1 (OR1C1) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 1C1, Olfactory receptor OR1-42, Olfactory receptor TPCR27

UniProt

Q15619

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKRNLTVVREFVLLGLPSSAEQQHLLSVLFLCMYLATTLGNMLIIATIGFDSHLHSPMY FFLSNLAFVDICFTSTTVPQMVVNILTGTKTISFAGCLTQLFFFVSFVNMDSLLLCVMAY DRYVAICHPLHYTARMNLCLCVQLVAGLWLVTYLHALLHTVLIAQLSFCASNIIHHFFCD LNPLLQLSCSDVSFNVMIIFAVGGLLALTPLVCILVSYGLIFSTVLKITSTQGKQRAVST CSCHLSVVVLFYGTAIAVYFSPSSPHMPESDTLSTIMYSMVAPMLNPFIYTLRNRDMKRG LQKMLLKCTVFQQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STK25 Human Gene Knockout Kit (CRISPR)
KN203215LP 1 Kit

STK25 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Laminin Receptor / RPSA (Marker of Metastatic Potential) (RPSA/2699), 0.2mg/mL
BNUB2699-500 1x 500 µL

Laminin Receptor / RPSA (Marker of Metastatic Potential) (RPSA/2699), 0.2mg/mL

Sign In for Pricing
View Details
GLP1 (GCG) (NM_002054) Human Over-expression Lysate
LC419562 20 µg

GLP1 (GCG) (NM_002054) Human Over-expression Lysate

Sign In for Pricing
View Details
HSPD1 Antibody
KC-1211-01 50 μL

HSPD1 Antibody

Sign In for Pricing
View Details
HSPD1 Antibody
KC-1211-02 100 µL

HSPD1 Antibody

Sign In for Pricing
View Details
HSPD1 Antibody
KC-1211-03 1 mL

HSPD1 Antibody

Sign In for Pricing
View Details