Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5I1 (OR5I1)

This Recombinant Human Olfactory receptor 5I1 (OR5I1) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 5I1, Olfactory receptor OR11-159, Olfactory receptor-like protein OLF1

UniProt

Q13606

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEFTDRNYTLVTEFILLGFPTRPELQIVLFLMFLTLYAIILIGNIGLMLLIRIDPHLQTP MYFFLSNLSFVDLCYFSDIVPKMLVNFLSENKSISYYGCALQFYFFCTFADTESFILAAM AYDRYVAICNPLLYTVVMSRGICMRLIVLSYLGGNMSSLVHTSFAFILKYCDKNVINHFF CDLPPLLKLSCTDTTINEWLLSTYGSSVEIICFIIIIISYFFILLSVLKIRSFSGRKKTF STCASHLTSVTIYQGTLLFIYSRPSYLYSPNTDKIISVFYTIFIPVLNPLIYSLRNKDVK DAAEKVLRSKVDSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 488 Rat IgG2a, λ Isotype Control[B39-4]
E-AB-F09743L-01 25 µg

Elab Fluor® 488 Rat IgG2a, λ Isotype Control[B39-4]

Sign In for Pricing
View Details
Elab Fluor® 488 Rat IgG2a, λ Isotype Control[B39-4]
E-AB-F09743L-02 100 µg

Elab Fluor® 488 Rat IgG2a, λ Isotype Control[B39-4]

Sign In for Pricing
View Details
Lycopersicon Esculentum (Tomato) Lectin (LEL, TL), CF®568 Conjugate
#29104 1x 1 mL

Lycopersicon Esculentum (Tomato) Lectin (LEL, TL), CF®568 Conjugate

Sign In for Pricing
View Details
Human CXCL2/MIP-2 Recombinant Rabbit monoclonal Antibody
HA725248 100 µL

Human CXCL2/MIP-2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Superoxide Dismutase 1 (SOD1) Human Gene Knockout Kit (CRISPR)
KN200725 1 Kit

Superoxide Dismutase 1 (SOD1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Decyl Maltose Neopentyl Glycol
TRC-D525770-25MG 25 mg

Decyl Maltose Neopentyl Glycol

Sign In for Pricing
View Details