Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Adenosine receptor A3 (ADORA3)

This Recombinant Dog Adenosine receptor A3 (ADORA3) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Adenosine receptor A3

UniProt

Q28309

Expression Region

1-314

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVNGTALLLANVTYITVEILIGLCAIVGNVLVIWVVKLNPSLQTTTFYFIVSLALADIA VGVLVMPLAIVISLGITIQFYNCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYRR VTTQRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEHQRNVTFLSCQFSSVMRMDYMVYF SFFTWILIPLVVMCAIYLDIFYVIRNKLNQNFSSSKETGAFYGREFKTAKSLFLVLFLFA FSWLPLSIINCITYFHGEVPQIILYLGILLSHANSMMNPIVYAYKIKKFKETYLLIFKTY MICQSSDSLDSSTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TDRD10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2355105 3x 1.0 µg

TDRD10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rat Versican (VCAN) ELISA Kit
abx518531-01 96 Tests

Rat Versican (VCAN) ELISA Kit

Sign In for Pricing
View Details
Rat Versican (VCAN) ELISA Kit
abx518531-02 5x 96 Tests

Rat Versican (VCAN) ELISA Kit

Sign In for Pricing
View Details
Rat Versican (VCAN) ELISA Kit
abx518531-03 10x 96 Tests

Rat Versican (VCAN) ELISA Kit

Sign In for Pricing
View Details
TRIM40 CRISPR/Cas9 KO Plasmid (m)
sc-431480 20 µg

TRIM40 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Slc6a7 ORF Vector (Rat) (pORF)
ORF076593 1.0 µg DNA

Slc6a7 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details