Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Taste receptor type 2 member 42 (TAS2R42)

This Recombinant Macaca mulatta Taste receptor type 2 member 42 (TAS2R42) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 42, T2R42, T2R55

UniProt

Q645T9

Expression Region

1-314

Origin

Macaca mulatta (Rhesus macaque)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATEMDKIFLTLATVEFIIGMLGNVFIGLVNCSEGIKNQKVFSVDFILTCLAISTIGHLL VILFDSCVVGLAPHLYATDRVRRPVTMLWHMXNHLTTWLATCLSIFYFFKIAHFPHSLFL WLRWRMNRVIAILLTLSLFLLIFDCLVLEMFIDXSLNIIDKSNLTLYLDESKTPYDKLSL LKILLSLNSFIPFSLCLTSLLFLFLSLVRHTRNLKLSSLGSRDSSTEAHRRAMKMVMSLL FLFIVHFFSLQVANWTFCILGNNKYTQFVTLALHAFPSCHSFILILGNSKLRQTAVRLLW HLRNYTKRPNPLPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF405S conjugate, 0.1mg/mL
BNC040338-100 1x 100 µL

P53 (PAb122), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF740 conjugate, 0.1mg/mL
BNC740338-100 1x 100 µL

P53 (PAb122), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL
BNC400391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
BNC740029-100 1x 100 µL

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL
BNC470676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF640R conjugate, 0.1mg/mL
BNC400175-100 1x 100 µL

CD46 (122.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details