Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2W3 (OR2W3)

This Recombinant Human Olfactory receptor 2W3 (OR2W3) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 2W3, Olfactory receptor 2W8, Olfactory receptor OR1-49

UniProt

Q7Z3T1

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGTNGSTQTHFILLGFSDRPHLERILFVVILIAYLLTLVGNTTIILVSRLDPHLHTPMY FFLAHLSFLDLSFTTSSIPQLLYNLNGCDKTISYMGCAIQLFLFLGLGGVECLLLAVMAY DRCVAICKPLHYMVIMNPRLCRGLVSVTWGCGVANSLAMSPVTLRLPRCGHHEVDHFLRE MPALIRMACVSTVAIEGTVFVLAVGVVLSPLVFILLSYSYIVRAVLQIRSASGRQKAFGT CGSHLTVVSLFYGNIIYMYMQPGASSSQDQGMFLMLFYNIVTPLLNPLIYTLRNREVKGA LGRLLLGKRELGKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C19orf10 Rabbit pAb (APR18306N)
APR18306N-01 50 µL

C19orf10 Rabbit pAb (APR18306N)

Sign In for Pricing
View Details
C19orf10 Rabbit pAb (APR18306N)
APR18306N-02 100 µL

C19orf10 Rabbit pAb (APR18306N)

Sign In for Pricing
View Details
C19orf10 Rabbit pAb (APR18306N)
APR18306N-03 200 µL

C19orf10 Rabbit pAb (APR18306N)

Sign In for Pricing
View Details
CSNK1E, CT (Casein Kinase I, epsilon Isoform, CKI-epsilon, CKIe) (Azide free) (HRP)
MBS6467354-01 0.2 mL

CSNK1E, CT (Casein Kinase I, epsilon Isoform, CKI-epsilon, CKIe) (Azide free) (HRP)

Sign In for Pricing
View Details
CSNK1E, CT (Casein Kinase I, epsilon Isoform, CKI-epsilon, CKIe) (Azide free) (HRP)
MBS6467354-02 5x 0.2 mL

CSNK1E, CT (Casein Kinase I, epsilon Isoform, CKI-epsilon, CKIe) (Azide free) (HRP)

Sign In for Pricing
View Details
Annexin VII Rabbit mAb
orb1565264-01 20 ul

Annexin VII Rabbit mAb

Sign In for Pricing
View Details