Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2W3 (OR2W3)

This Recombinant Human Olfactory receptor 2W3 (OR2W3) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 2W3, Olfactory receptor 2W8, Olfactory receptor OR1-49

UniProt

Q7Z3T1

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGTNGSTQTHFILLGFSDRPHLERILFVVILIAYLLTLVGNTTIILVSRLDPHLHTPMY FFLAHLSFLDLSFTTSSIPQLLYNLNGCDKTISYMGCAIQLFLFLGLGGVECLLLAVMAY DRCVAICKPLHYMVIMNPRLCRGLVSVTWGCGVANSLAMSPVTLRLPRCGHHEVDHFLRE MPALIRMACVSTVAIEGTVFVLAVGVVLSPLVFILLSYSYIVRAVLQIRSASGRQKAFGT CGSHLTVVSLFYGNIIYMYMQPGASSSQDQGMFLMLFYNIVTPLLNPLIYTLRNREVKGA LGRLLLGKRELGKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA Ligase IV (LIG4) (NM_001098268) Human Untagged Clone
SC316278 10 µg

DNA Ligase IV (LIG4) (NM_001098268) Human Untagged Clone

Sign In for Pricing
View Details
Bovine Ankyrin repeat domain containing protein 39 (ANKRD39) ELISA Kit
GTR10320765 96 Well

Bovine Ankyrin repeat domain containing protein 39 (ANKRD39) ELISA Kit

Sign In for Pricing
View Details
HPS6 ELISA Kit (Human) (OKCD09398)
OKCD09398 96 Well

HPS6 ELISA Kit (Human) (OKCD09398)

Sign In for Pricing
View Details
2-chloro-N- (2-cyclohexylethyl) acetamide
EXB76209-01 100 mg

2-chloro-N- (2-cyclohexylethyl) acetamide

Sign In for Pricing
View Details
2-chloro-N- (2-cyclohexylethyl) acetamide
EXB76209-02 1 g

2-chloro-N- (2-cyclohexylethyl) acetamide

Sign In for Pricing
View Details
Phospho-Tau (Ser324) Rabbit mAb, 1 pack = 20 µL
BAL2397 1 Each

Phospho-Tau (Ser324) Rabbit mAb, 1 pack = 20 µL

Sign In for Pricing
View Details