Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2Z1 (OR2Z1)

This Recombinant Human Olfactory receptor 2Z1 (OR2Z1) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 2Z1, Olfactory receptor 2Z2, Olfactory receptor OR19-4

UniProt

Q8NG97

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDVNQSVASDFILVGLFSHSGSRQLLFSLVAVMFVIGLLGNTVLLFLIRVDSRLHTPMY FLLSQLSLFDIGCPMVTIPKMASDFLRGEGATSYGGGAAQIFFLTLMGVAEGVLLVLMSY DRYVAVCQPLQYPVLMRRQVCLLMMGSSWVVGVLNASIQTSITLHFPYCASRIVDHFFCE VPALLKLSCADTCAYEMALSTSGVLILMLPLSLIATSYGHVLQAVLSMRSEEARHKAVTT CSSHITVVGLFYGAAVFMYMVPCAYHSPQQDNVVSLFYSLVTPTLNPLIYSLRNPEVWMA LVKVLSRAGLRQMC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Factor XIII Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-1587R-BF647-TR 20 µL

Factor XIII Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Human Plexin-B2 (PLXNB2) ELISA Kit
EK8418 48 Tests

Human Plexin-B2 (PLXNB2) ELISA Kit

Sign In for Pricing
View Details
ADCYAP1R1 Adenovirus (Rat)
11402056 1.0 mL

ADCYAP1R1 Adenovirus (Rat)

Sign In for Pricing
View Details
Mouse LOC667452 (NM_001195730) AAV Particle
MR226987A1V 250 µL

Mouse LOC667452 (NM_001195730) AAV Particle

Sign In for Pricing
View Details
STAR Antibody, mAb, Rabbit
A03889-100 100 µL

STAR Antibody, mAb, Rabbit

Sign In for Pricing
View Details
TRIM46 (m) -PR
sc-154654-PR 10 µM - 20 µL

TRIM46 (m) -PR

Sign In for Pricing
View Details