Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2Z1 (OR2Z1)

This Recombinant Human Olfactory receptor 2Z1 (OR2Z1) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 2Z1, Olfactory receptor 2Z2, Olfactory receptor OR19-4

UniProt

Q8NG97

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDVNQSVASDFILVGLFSHSGSRQLLFSLVAVMFVIGLLGNTVLLFLIRVDSRLHTPMY FLLSQLSLFDIGCPMVTIPKMASDFLRGEGATSYGGGAAQIFFLTLMGVAEGVLLVLMSY DRYVAVCQPLQYPVLMRRQVCLLMMGSSWVVGVLNASIQTSITLHFPYCASRIVDHFFCE VPALLKLSCADTCAYEMALSTSGVLILMLPLSLIATSYGHVLQAVLSMRSEEARHKAVTT CSSHITVVGLFYGAAVFMYMVPCAYHSPQQDNVVSLFYSLVTPTLNPLIYSLRNPEVWMA LVKVLSRAGLRQMC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHRAC1 (NM_017444) Human Over-expression Lysate
LS054108 100 µg

CHRAC1 (NM_017444) Human Over-expression Lysate

Sign In for Pricing
View Details
liver FBPase Double Nickase Plasmid (m)
sc-420299-NIC 20 µg

liver FBPase Double Nickase Plasmid (m)

Sign In for Pricing
View Details
MFSD6, CT (MFSD6, MMR2, Major facilitator superfamily domain-containing protein 6, Macrophage MHC class I receptor 2 homolog) (MaxLight 650)
MBS6320599-01 0.1 mL

MFSD6, CT (MFSD6, MMR2, Major facilitator superfamily domain-containing protein 6, Macrophage MHC class I receptor 2 homolog) (MaxLight 650)

Sign In for Pricing
View Details
MFSD6, CT (MFSD6, MMR2, Major facilitator superfamily domain-containing protein 6, Macrophage MHC class I receptor 2 homolog) (MaxLight 650)
MBS6320599-02 5x 0.1 mL

MFSD6, CT (MFSD6, MMR2, Major facilitator superfamily domain-containing protein 6, Macrophage MHC class I receptor 2 homolog) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Solanum lycopersicum Photosystem II reaction center protein I (psbI), partial
MBS7076751 Inquire

Recombinant Solanum lycopersicum Photosystem II reaction center protein I (psbI), partial

Sign In for Pricing
View Details
Monoclonal CD57 / B3GAT1 (Natural Killer Cell Marker) Antibody - With BSA and Azide, Clone: HNK-1 or Leu-7
AMM00747G 0.05mg

Monoclonal CD57 / B3GAT1 (Natural Killer Cell Marker) Antibody - With BSA and Azide, Clone: HNK-1 or Leu-7

Sign In for Pricing
View Details