Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2Z1 (OR2Z1)

This Recombinant Human Olfactory receptor 2Z1 (OR2Z1) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 2Z1, Olfactory receptor 2Z2, Olfactory receptor OR19-4

UniProt

Q8NG97

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDVNQSVASDFILVGLFSHSGSRQLLFSLVAVMFVIGLLGNTVLLFLIRVDSRLHTPMY FLLSQLSLFDIGCPMVTIPKMASDFLRGEGATSYGGGAAQIFFLTLMGVAEGVLLVLMSY DRYVAVCQPLQYPVLMRRQVCLLMMGSSWVVGVLNASIQTSITLHFPYCASRIVDHFFCE VPALLKLSCADTCAYEMALSTSGVLILMLPLSLIATSYGHVLQAVLSMRSEEARHKAVTT CSSHITVVGLFYGAAVFMYMVPCAYHSPQQDNVVSLFYSLVTPTLNPLIYSLRNPEVWMA LVKVLSRAGLRQMC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gzma (Granzyme A) ELISA Kit
FY-EM3065 96 Well

Mouse Gzma (Granzyme A) ELISA Kit

Sign In for Pricing
View Details
11 (R) -HETE
sc-204974A 50 µg

11 (R) -HETE

Sign In for Pricing
View Details
Mouse Onecut3 Pre-designed siRNA Set A
SI109824A 1 Each

Mouse Onecut3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Oseltamivir acid
orb1302015-01 1 mg

Oseltamivir acid

Sign In for Pricing
View Details
Oseltamivir acid
orb1302015-02 5 mg

Oseltamivir acid

Sign In for Pricing
View Details
Oseltamivir acid
orb1302015-03 1 ml x 10 mM (in DMSO)

Oseltamivir acid

Sign In for Pricing
View Details