Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 492 (Olfr492)

This Recombinant Mouse Olfactory receptor 492 (Olfr492) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 492, Olfactory receptor 204-18

UniProt

Q8VFD1

Expression Region

1-314

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLEDGNHTAVTEFILLGLTDDPVLRVILFTIILCIYLVTVSGNLSTILLIRVSSQLHH PMYFFLSHVGSVDIGYSSSVTPNMLVNFLVEKHTIAYLGCGIQLSSAAFFGTAECFLLAT MAYDRFVAICNPLLYSTKMSTQTCIQLVVGSYTGGILNASFAIISFFSFLFCGPNRINHF YCDFAPLVELSCSDINVSVVITTIFSASVTIITVFVIAISYTYILITILKMRSTEGRHKA FSTCTSYLTAVTLFYGTVTFIYVVPKSNYSTDQNKVASVFYIVVIPMLNPLIYSLRNNDI KGALKRQLGKKTFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC19 Rabbit pAb, IRDye 800CW conjugated
orb2848402 100 µL

MUC19 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Chicken Soluble Lectin-like oxidized low density lipoprotein receptor-1 (sLOX-1) ELISA Kit
EIA07654Ch 1 Kit

Chicken Soluble Lectin-like oxidized low density lipoprotein receptor-1 (sLOX-1) ELISA Kit

Sign In for Pricing
View Details
1700019A02Rik Recombinant Protein (Mouse)
RP110213 100 µg

1700019A02Rik Recombinant Protein (Mouse)

Sign In for Pricing
View Details
PGC Rabbit Polyclonal Antibody (BF555)
orb2505292 100 µL

PGC Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
IL6R Rabbit pAb
E45R22271N 50 ul

IL6R Rabbit pAb

Sign In for Pricing
View Details
ZNF763 Rabbit Polyclonal Antibody
orb668751-01 30 µL

ZNF763 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details