Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 502 (Olfr502)

This Recombinant Mouse Olfactory receptor 502 (Olfr502) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 502, Olfactory receptor 204-8

UniProt

Q8VG09

Expression Region

1-314

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLEDGNHTAVTGFILLGLTDDPVLRVVLFVIILCIYLVTVSGNLSTILLIRVSSQLHH PMYFFLSHLASADIGYSSSVTPNMLVNFLVERNTISYLGCGIQLGSAVFFGTVECFLLAA MAYDRFIAICSPLLYSNKMSTQVCVQLLVGSYIGGFLNASSFTLSFFSLVFCGPNRVNHF FCDFAPLVKLSCSDVSVPAVVPSFTAGSIIIVTIFVIAVSYIYILITILKMRSTEGRQKA FSTCTSHLTAVTLFYGTITFIYVMPKSSYSTDQNKVVSVFYMVVVPMLNPLIYSLRNKEI KGALKRQLAKNTFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Borrelia Turicatae rpmH Protein (aa 1-51)
VAng-Lsx2513-50gEcoli 50 µg (E. coli)

Recombinant Borrelia Turicatae rpmH Protein (aa 1-51)

Sign In for Pricing
View Details
SYNGR4 Protein Vector (Rat) (pPB-C-His)
PV309230 500 ng

SYNGR4 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
PKC θ Polyclonal Antibody
RA28824-01 50 µL

PKC θ Polyclonal Antibody

Sign In for Pricing
View Details
PKC θ Polyclonal Antibody
RA28824-02 100 µL

PKC θ Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal MMP21 Antibody (2F10)
H00118856-M01-100ug 100 µg

Mouse Monoclonal MMP21 Antibody (2F10)

Sign In for Pricing
View Details
NTAL Recombinant Protein Antigen
NBP1-89661PEP 0.1 mL

NTAL Recombinant Protein Antigen

Sign In for Pricing
View Details