Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4D9 (OR4D9)

This Recombinant Human Olfactory receptor 4D9 (OR4D9) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 4D9, Olfactory receptor OR11-253

UniProt

Q8NGE8

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDQRNYTRVKEFTFLGITQSRELSQVLFTFLFLVYMTTLMGNFLIMVTVTCESHLHTPMY FLLRNLSILDICFSSITAPKVLIDLLSETKTISFSGCVTQMFFFHLLGGADVFSLSVMAF DRYIAISKPLHYMTIMSRGRCTGLIVASWVGGFVHSIAQISLLLPLPFCGPNVLDTFYCD VPQVLKLACTDTFTLELLMISNNGLVSWFVFFFLLISYTVILMMLRSHTGEGRRKAISTC TSHITVVTLHFVPCIYVYARPFTALPTDTAISVTFTVISPLLNPIIYTLRNQEMKLAMRK LKRRLGQSERILIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BIN3 Protein Vector (Mouse) (pPM-C-HA)
13328024 500 ng

BIN3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
MAOA (Monoamine Oxidase A, MAO-A, MAOA) (Biotin)
MBS6425266-01 0.1 mL

MAOA (Monoamine Oxidase A, MAO-A, MAOA) (Biotin)

Sign In for Pricing
View Details
MAOA (Monoamine Oxidase A, MAO-A, MAOA) (Biotin)
MBS6425266-02 5x 0.1 mL

MAOA (Monoamine Oxidase A, MAO-A, MAOA) (Biotin)

Sign In for Pricing
View Details
Mtnr1b siRNA Oligos set (Mouse)
31082174 3x 5 nmol

Mtnr1b siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Gm2083 (NM_001134644) Mouse Tagged ORF Clone
MG213272 10 µg

Gm2083 (NM_001134644) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
General Block ELISA Blocking Buffer
orb623166 1 L

General Block ELISA Blocking Buffer

Sign In for Pricing
View Details