Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4D9 (OR4D9)

This Recombinant Human Olfactory receptor 4D9 (OR4D9) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 4D9, Olfactory receptor OR11-253

UniProt

Q8NGE8

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDQRNYTRVKEFTFLGITQSRELSQVLFTFLFLVYMTTLMGNFLIMVTVTCESHLHTPMY FLLRNLSILDICFSSITAPKVLIDLLSETKTISFSGCVTQMFFFHLLGGADVFSLSVMAF DRYIAISKPLHYMTIMSRGRCTGLIVASWVGGFVHSIAQISLLLPLPFCGPNVLDTFYCD VPQVLKLACTDTFTLELLMISNNGLVSWFVFFFLLISYTVILMMLRSHTGEGRRKAISTC TSHITVVTLHFVPCIYVYARPFTALPTDTAISVTFTVISPLLNPIIYTLRNQEMKLAMRK LKRRLGQSERILIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Muc5ac sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4382707 1.0 µg DNA

Muc5ac sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
NMDAR1 (Phospho-Ser897) Antibody
E11-7174A 100 µg

NMDAR1 (Phospho-Ser897) Antibody

Sign In for Pricing
View Details
TNFSF14 Antibody Blocking peptide
orb1455859 500 µg

TNFSF14 Antibody Blocking peptide

Sign In for Pricing
View Details
Stathmin 1 (STMN1) Antibody
abx331983 100 µL

Stathmin 1 (STMN1) Antibody

Sign In for Pricing
View Details
CYP46 Rabbit Polyclonal Antibody (Cy5.5)
orb1045769 100 µL

CYP46 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Recombinant Langya virus/LayV G/Glycoprotein, C-His
VK407021-01 50 µg

Recombinant Langya virus/LayV G/Glycoprotein, C-His

Sign In for Pricing
View Details