Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 9A4 (OR9A4)

This Recombinant Human Olfactory receptor 9A4 (OR9A4) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 9A4, Olfactory receptor OR7-1

UniProt

Q8NGU2

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLMNYSSATEFYLLGFPGSEELHHILFAIFFFFYLVTLMGNTVIIMIVCVDKRLQSPMYF FLGHLSALEILVTTIIVPVMLWGLLLPGMQTIYLSACVVQLFLYLAVGTTEFALLGAMAV DRYVAVCNPLRYNIIMNRHTCNFVVLVSWVFGFLFQIWPVYVMFQLTYCKSNVVNNFFCD RGQLLKLSCNNTLFTEFILFLMAVFVLFGSLIPTIVSNAYIISTILKIPSSSGRRKSFST CASHFTCVVIGYGSCLFLYVKPKQTQAADYNWVVSLMVSVVTPFLNPFIFTLRNDKVIEA LRDGVKRCCQLFRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR (Epidermal Growth Factor Receptor) (rGFR/1667), CF568 conjugate, 0.1mg/mL
BNC683605-500 1x 500 µL

EGFR (Epidermal Growth Factor Receptor) (rGFR/1667), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RAB45 Recombinant Rabbit Monoclonal Antibody [JE65-33]
HA721097 100 µL

RAB45 Recombinant Rabbit Monoclonal Antibody [JE65-33]

Sign In for Pricing
View Details
Viability/Cytotoxity Assay Kit for Animal Live & Dead Cells (300 assays)
#30002 1 Kit

Viability/Cytotoxity Assay Kit for Animal Live & Dead Cells (300 assays)

Sign In for Pricing
View Details
CD28 Antibody
KC-7257-01 50 μL

CD28 Antibody

Sign In for Pricing
View Details
CD28 Antibody
KC-7257-02 100 µL

CD28 Antibody

Sign In for Pricing
View Details
CD28 Antibody
KC-7257-03 1 mL

CD28 Antibody

Sign In for Pricing
View Details