Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 9A4 (OR9A4)

This Recombinant Human Olfactory receptor 9A4 (OR9A4) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 9A4, Olfactory receptor OR7-1

UniProt

Q8NGU2

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLMNYSSATEFYLLGFPGSEELHHILFAIFFFFYLVTLMGNTVIIMIVCVDKRLQSPMYF FLGHLSALEILVTTIIVPVMLWGLLLPGMQTIYLSACVVQLFLYLAVGTTEFALLGAMAV DRYVAVCNPLRYNIIMNRHTCNFVVLVSWVFGFLFQIWPVYVMFQLTYCKSNVVNNFFCD RGQLLKLSCNNTLFTEFILFLMAVFVLFGSLIPTIVSNAYIISTILKIPSSSGRRKSFST CASHFTCVVIGYGSCLFLYVKPKQTQAADYNWVVSLMVSVVTPFLNPFIFTLRNDKVIEA LRDGVKRCCQLFRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin Conjugated Artocarpus integrifolia Lectin (Jackfruit) -JacalinAIA-
BA-6301-5 5 mg

Biotin Conjugated Artocarpus integrifolia Lectin (Jackfruit) -JacalinAIA-

Sign In for Pricing
View Details
CD80 (B7-1) (C80/2723), CF488A conjugate, 0.1mg/mL
BNC882723-500 1x 500 µL

CD80 (B7-1) (C80/2723), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Atomic Absorption Spectrophotometer BAAS-604
BAAS-604 1 Unit

Atomic Absorption Spectrophotometer BAAS-604

Sign In for Pricing
View Details
Nck (NCK1) Mouse Monoclonal Antibody [Clone ID: 5B7]
AM06766PU-N 100 µg

Nck (NCK1) Mouse Monoclonal Antibody [Clone ID: 5B7]

Sign In for Pricing
View Details
Mix-n-StainTM CF®660R Antibody Labeling Kit, 1x (50-100ug) labeling
#92243 1 Kit

Mix-n-StainTM CF®660R Antibody Labeling Kit, 1x (50-100ug) labeling

Sign In for Pricing
View Details
Bcl-2 (100/D5), 0.2mg/mL
BNUB0045-100 1x 100 µL

Bcl-2 (100/D5), 0.2mg/mL

Sign In for Pricing
View Details