Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 10T2 (OR10T2)

This Recombinant Human Olfactory receptor 10T2 (OR10T2) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 10T2, Olfactory receptor OR1-3

UniProt

Q8NGX3

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRGFNKTTVVTQFILVGFSSLGELQLLLFVIFLLLYLTILVANVTIMAVIRFSWTLHTPM YGFLFILSFSESCYTFVIIPQLLVHLLSDTKTISFMACATQLFFFLGFACTNCLLIAVMG YDRYVAICHPLRYTLIINKRLGLELISLSGATGFFIALVATNLICDMRFCGPNRVNHYFC DMAPVIKLACTDTHVKELALFSLSILVIMVPFLLILISYGFIVNTILKIPSAEGKKAFVT CASHLTVVFVHYGCASIIYLRPKSKSASDKDQLVAVTYTVVTPLLNPLVYSLRNKEVKTA LKRVLGMPVATKMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIFA, NT (TIFA, T2BP, TRAF-interacting protein with FHA domain-containing protein A, Putative MAPK-activating protein PM14, Putative NF-kappa-B-activating protein 20, TRAF2-binding protein) (MaxLight 550) discontinued
042830-ML550 100 µL

TIFA, NT (TIFA, T2BP, TRAF-interacting protein with FHA domain-containing protein A, Putative MAPK-activating protein PM14, Putative NF-kappa-B-activating protein 20, TRAF2-binding protein) (MaxLight 550) discontinued

Sign In for Pricing
View Details
POS5 Antibody
orb848801 2 mg

POS5 Antibody

Sign In for Pricing
View Details
Fbxo11 Antibody - C-terminal region : HRP (ARP43326_P050-HRP)
ARP43326_P050-HRP 100 µL

Fbxo11 Antibody - C-terminal region : HRP (ARP43326_P050-HRP)

Sign In for Pricing
View Details
Recombinant Saccharomyces Cerevisiae SFH5 Protein (aa 1-294) [His] (strain ATCC 204508 / S288c)
VAng-Wyb5759-1mg 1 mg

Recombinant Saccharomyces Cerevisiae SFH5 Protein (aa 1-294) [His] (strain ATCC 204508 / S288c)

Sign In for Pricing
View Details
Human Kinesin Heavy Chain 2 (KIF2A) (NM_001098511) AAV Particle
RC218381A1V 250 µL

Human Kinesin Heavy Chain 2 (KIF2A) (NM_001098511) AAV Particle

Sign In for Pricing
View Details
Protein Kinase A reguLatory subunit I alpha (PRKAR1A) (NM_001276289) Human Untagged Clone
SC331041 10 µg

Protein Kinase A reguLatory subunit I alpha (PRKAR1A) (NM_001276289) Human Untagged Clone

Sign In for Pricing
View Details