Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 493 (Olfr493)

This Recombinant Mouse Olfactory receptor 493 (Olfr493) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 493, Olfactory receptor 204-35

UniProt

Q8VEW5

Expression Region

1-314

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLHNGNHTAVTEFILLGLTDDPVFRVILFTIILCIYLVTVSGNLSTILLIRVSSQLHH PMYFFLSHLASVDIGYSSSVTPNMLANFLVEKNTISYLGCTIQLSLAAFCGTVECFLLAT MAYDRFMAICSPLLYSTKMSTQVCIQLIVGSYIGGFLNASSFTLFFLSFLFCGPNRINHF YCDFAPLVALSCSDVSVSEVVTSFFSGSVTMITMLVIAISYTYILITILKMRSTEGRHKA FSTCTSHLTAVTLFYGTITFIYVMPKSSFSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEI KDALKRHLGKKIFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Galectin-1 Antibody, Rabbit Polyclonal
MBS8103410-01 0.1 mL

Anti-Galectin-1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-Galectin-1 Antibody, Rabbit Polyclonal
MBS8103410-02 5x 0.1 mL

Anti-Galectin-1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Olr1350 (NM_001000752) Rat Tagged ORF Clone
RR213398 10 µg

Olr1350 (NM_001000752) Rat Tagged ORF Clone

Sign In for Pricing
View Details
pLentiCRISPRV2-U6-WWTR1-sgRNA1-EF1a-Cas9-P2A-Puro-WPR Plasmid
PVT34077 2 µg

pLentiCRISPRV2-U6-WWTR1-sgRNA1-EF1a-Cas9-P2A-Puro-WPR Plasmid

Sign In for Pricing
View Details
LOC100362322 3'UTR GFP Stable Cell Line
TU258293 1.0 mL

LOC100362322 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-SIRT2 antibody
STJ25534 100 µl

Anti-SIRT2 antibody

Sign In for Pricing
View Details