Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 493 (Olfr493)

This Recombinant Mouse Olfactory receptor 493 (Olfr493) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 493, Olfactory receptor 204-35

UniProt

Q8VEW5

Expression Region

1-314

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLHNGNHTAVTEFILLGLTDDPVFRVILFTIILCIYLVTVSGNLSTILLIRVSSQLHH PMYFFLSHLASVDIGYSSSVTPNMLANFLVEKNTISYLGCTIQLSLAAFCGTVECFLLAT MAYDRFMAICSPLLYSTKMSTQVCIQLIVGSYIGGFLNASSFTLFFLSFLFCGPNRINHF YCDFAPLVALSCSDVSVSEVVTSFFSGSVTMITMLVIAISYTYILITILKMRSTEGRHKA FSTCTSHLTAVTLFYGTITFIYVMPKSSFSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEI KDALKRHLGKKIFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Bone-specific Alkphase B (ALP-B) ELISA Kit
EIA05241p 1 Kit

Porcine Bone-specific Alkphase B (ALP-B) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human SMIM27 sgRNA gene knockout kit - Lentiviral human SMIM27 sgRNA gene knockout kit (25)
GTR15357285 1 Vial

Lentiviral human SMIM27 sgRNA gene knockout kit - Lentiviral human SMIM27 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Human AMTN Protein
B2011717 100 µg

Human AMTN Protein

Sign In for Pricing
View Details
Leucine-Rich Repeat-Containing Protein 37B (LRRC37B) Antibody
abx027267-01 80 µL

Leucine-Rich Repeat-Containing Protein 37B (LRRC37B) Antibody

Sign In for Pricing
View Details
Leucine-Rich Repeat-Containing Protein 37B (LRRC37B) Antibody
abx027267-02 400 µL

Leucine-Rich Repeat-Containing Protein 37B (LRRC37B) Antibody

Sign In for Pricing
View Details
Ttc19 (NM_028360) Mouse Tagged ORF Clone Lentiviral Particle
MR220513L3V 200 µL

Ttc19 (NM_028360) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details