Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 493 (Olfr493)

This Recombinant Mouse Olfactory receptor 493 (Olfr493) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 493, Olfactory receptor 204-35

UniProt

Q8VEW5

Expression Region

1-314

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLHNGNHTAVTEFILLGLTDDPVFRVILFTIILCIYLVTVSGNLSTILLIRVSSQLHH PMYFFLSHLASVDIGYSSSVTPNMLANFLVEKNTISYLGCTIQLSLAAFCGTVECFLLAT MAYDRFMAICSPLLYSTKMSTQVCIQLIVGSYIGGFLNASSFTLFFLSFLFCGPNRINHF YCDFAPLVALSCSDVSVSEVVTSFFSGSVTMITMLVIAISYTYILITILKMRSTEGRHKA FSTCTSHLTAVTLFYGTITFIYVMPKSSFSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEI KDALKRHLGKKIFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppp1r14a 3'UTR Lenti-reporter-Luc Vector
37410084 1.0 µg

Ppp1r14a 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
NFE2L1 discontinued
392159 200 µL

NFE2L1 discontinued

Sign In for Pricing
View Details
CLEC6A Rabbit Polyclonal Antibody (FITC)
orb2119062 100 µL

CLEC6A Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
ANP (F-2) Alexa Fluor® 790
sc-515701 AF790 200 µg/mL

ANP (F-2) Alexa Fluor® 790

Sign In for Pricing
View Details
MPDU1, CT (MPDU1, Mannose-P-dolichol utilization defect 1 protein, Suppressor of Lec15 and Lec35 glycosylation mutation homolog) (AP)
MBS6321856-01 0.2 mL

MPDU1, CT (MPDU1, Mannose-P-dolichol utilization defect 1 protein, Suppressor of Lec15 and Lec35 glycosylation mutation homolog) (AP)

Sign In for Pricing
View Details
MPDU1, CT (MPDU1, Mannose-P-dolichol utilization defect 1 protein, Suppressor of Lec15 and Lec35 glycosylation mutation homolog) (AP)
MBS6321856-02 5x 0.2 mL

MPDU1, CT (MPDU1, Mannose-P-dolichol utilization defect 1 protein, Suppressor of Lec15 and Lec35 glycosylation mutation homolog) (AP)

Sign In for Pricing
View Details