Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 1 (Olfr1)

This Recombinant Mouse Olfactory receptor 1 (Olfr1) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 1, Odorant receptor I54, Olfactory receptor 135-13

UniProt

Q8VGI1

Expression Region

1-314

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTERNKTVISQFLLLGLPIPPEHQQLFYALFLVMYLTTVLGNLIIIILIILDSHLHTPMY LFLSNLSFSDLCFSSVTMPKLLQNMQSQVPSIPYAGCLAQIYFFLFFGDLGNFLLVAMAY DRYVAICYPLHYTTIMSPRLCVSLVVLSWVLTTFHAMLHTLLMARLSFCEDNVIPHYFCD MSALLKLACSDTRVNEVVIFIVASIFLVLPFALITMSYVRIVSSILKVPSSQGIYKAFST CGSHLSVVSLFYGTVIGLYLSPSSNNSTVKDTVMSLMYTVVTPMLNPFIYSLRNRDIKGA LERVFCKRKIQLNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HECTD2 Antibody
OC-169-01 50 μL

HECTD2 Antibody

Sign In for Pricing
View Details
HECTD2 Antibody
OC-169-02 100 µL

HECTD2 Antibody

Sign In for Pricing
View Details
HECTD2 Antibody
OC-169-03 1 mL

HECTD2 Antibody

Sign In for Pricing
View Details
CD44v4/5 (Marker of Tumor Metastasis) (3D2), CF568 conjugate, 0.1mg/mL
BNC683075-500 1x 500 µL

CD44v4/5 (Marker of Tumor Metastasis) (3D2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Epstein-Barr Virus (LMP-1) (CS2), CF640R conjugate, 0.1mg/mL
BNC401742-500 1x 500 µL

Epstein-Barr Virus (LMP-1) (CS2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ABCF3 Human Gene Knockout Kit (CRISPR)
KN201403LP 1 Kit

ABCF3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details