Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 1 (Olfr1)

This Recombinant Mouse Olfactory receptor 1 (Olfr1) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 1, Odorant receptor I54, Olfactory receptor 135-13

UniProt

Q8VGI1

Expression Region

1-314

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTERNKTVISQFLLLGLPIPPEHQQLFYALFLVMYLTTVLGNLIIIILIILDSHLHTPMY LFLSNLSFSDLCFSSVTMPKLLQNMQSQVPSIPYAGCLAQIYFFLFFGDLGNFLLVAMAY DRYVAICYPLHYTTIMSPRLCVSLVVLSWVLTTFHAMLHTLLMARLSFCEDNVIPHYFCD MSALLKLACSDTRVNEVVIFIVASIFLVLPFALITMSYVRIVSSILKVPSSQGIYKAFST CGSHLSVVSLFYGTVIGLYLSPSSNNSTVKDTVMSLMYTVVTPMLNPFIYSLRNRDIKGA LERVFCKRKIQLNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SETD4 (NM_001007259) Human Over-expression Lysate
LC423476 20 µg

SETD4 (NM_001007259) Human Over-expression Lysate

Sign In for Pricing
View Details
INMT (NM_006774) Human Recombinant Protein
TP761226 50 µg

INMT (NM_006774) Human Recombinant Protein

Sign In for Pricing
View Details
Human TMEM128 activation kit by CRISPRa
GA113827 1 Kit

Human TMEM128 activation kit by CRISPRa

Sign In for Pricing
View Details
Human GOLM2 activation kit by CRISPRa
GA114394 1 Kit

Human GOLM2 activation kit by CRISPRa

Sign In for Pricing
View Details
Gal a(1,4)Gal b(1,4)GlcNac b-O-BSA Colloidal Gold Conjugate,  30nm
CCG-1010-30 1 mL

Gal a(1,4)Gal b(1,4)GlcNac b-O-BSA Colloidal Gold Conjugate, 30nm

Sign In for Pricing
View Details
t-Butyl (3R,5S)-7-[2-Cyclopropyl-4-(4-fluorophenyl)quinolin-3-yl]-3,5-isopropylidenedioxy-6-heptenoate
TRC-B689830-250MG 250 mg

t-Butyl (3R,5S)-7-[2-Cyclopropyl-4-(4-fluorophenyl)quinolin-3-yl]-3,5-isopropylidenedioxy-6-heptenoate

Sign In for Pricing
View Details