Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 1 (Olfr1)

This Recombinant Mouse Olfactory receptor 1 (Olfr1) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 1, Odorant receptor I54, Olfactory receptor 135-13

UniProt

Q8VGI1

Expression Region

1-314

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTERNKTVISQFLLLGLPIPPEHQQLFYALFLVMYLTTVLGNLIIIILIILDSHLHTPMY LFLSNLSFSDLCFSSVTMPKLLQNMQSQVPSIPYAGCLAQIYFFLFFGDLGNFLLVAMAY DRYVAICYPLHYTTIMSPRLCVSLVVLSWVLTTFHAMLHTLLMARLSFCEDNVIPHYFCD MSALLKLACSDTRVNEVVIFIVASIFLVLPFALITMSYVRIVSSILKVPSSQGIYKAFST CGSHLSVVSLFYGTVIGLYLSPSSNNSTVKDTVMSLMYTVVTPMLNPFIYSLRNRDIKGA LERVFCKRKIQLNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cobalt(II) Chloride Hexahydrate
TRC-C633133-250MG 250 mg

Cobalt(II) Chloride Hexahydrate

Sign In for Pricing
View Details
Uncoated Human C3a (Complement Component 3a) ELISA Kit
E-UNEL-H0021-01 5x 96 Tests

Uncoated Human C3a (Complement Component 3a) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human C3a (Complement Component 3a) ELISA Kit
E-UNEL-H0021-02 15x 96 Tests

Uncoated Human C3a (Complement Component 3a) ELISA Kit

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), 0.2mg/mL
BNUB0253-500 1x 500 µL

Cytokeratin, LMW (AE-1), 0.2mg/mL

Sign In for Pricing
View Details
PTX4 (NM_001013658) Human Over-expression Lysate
LY423007 100 µg

PTX4 (NM_001013658) Human Over-expression Lysate

Sign In for Pricing
View Details
CD40 Mouse Monoclonal Antibody [Clone ID: HI40a]
AM03135RP-N 100 Tests

CD40 Mouse Monoclonal Antibody [Clone ID: HI40a]

Sign In for Pricing
View Details