Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 14A2 (OR14A2)

This Recombinant Human Olfactory receptor 14A2 (OR14A2) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 14A2, Olfactory receptor 5AX1, Olfactory receptor OR1-31

UniProt

Q96R54

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANVTLVTGFLLMGFSNIQKLRILYGVLFLLIYLAALMSNLLIITLITLDVKLQTPMYFF LKNLSFLDVFLVSVPIPKFIVNNLTHNNSISILGCAFQLLLMTSFSAGEIFILTAMSYDR YVAICCPLNYEVIMNTGVCVLMASVSWAIGGLFGTAYTAGTFSMPFCGSSVIPQFFCDVP SLLRISCSETLMVIYAGIGVGACLSISCFICIVISYIYIFSTVLKIPTTKGQSKAFSTCF PHLTVFTVFIITAYFVYLKPPSNSPSVIDRLLSVIYTVMPPVFNPVTYSLRNNDMKCALI RLLQKTYGQEAYFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF286 shRNA (m) Lentiviral Particles
sc-155677-V 200 µL

ZNF286 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Recombinant Human Contactin-associated protein-like 5 (CNTNAP5) , partial
MBS1308755 Inquire

Recombinant Human Contactin-associated protein-like 5 (CNTNAP5) , partial

Sign In for Pricing
View Details
Sigma Receptor shRNA (m) Lentiviral Particles
sc-42251-V 200 µL

Sigma Receptor shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
CS048 rabbit pAb
MBS8597904-01 0.1 mL

CS048 rabbit pAb

Sign In for Pricing
View Details
CS048 rabbit pAb
MBS8597904-02 0.1 mL (AF405L)

CS048 rabbit pAb

Sign In for Pricing
View Details
CS048 rabbit pAb
MBS8597904-03 0.1 mL (AF405S)

CS048 rabbit pAb

Sign In for Pricing
View Details