Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 14A2 (OR14A2)

This Recombinant Human Olfactory receptor 14A2 (OR14A2) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 14A2, Olfactory receptor 5AX1, Olfactory receptor OR1-31

UniProt

Q96R54

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANVTLVTGFLLMGFSNIQKLRILYGVLFLLIYLAALMSNLLIITLITLDVKLQTPMYFF LKNLSFLDVFLVSVPIPKFIVNNLTHNNSISILGCAFQLLLMTSFSAGEIFILTAMSYDR YVAICCPLNYEVIMNTGVCVLMASVSWAIGGLFGTAYTAGTFSMPFCGSSVIPQFFCDVP SLLRISCSETLMVIYAGIGVGACLSISCFICIVISYIYIFSTVLKIPTTKGQSKAFSTCF PHLTVFTVFIITAYFVYLKPPSNSPSVIDRLLSVIYTVMPPVFNPVTYSLRNNDMKCALI RLLQKTYGQEAYFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFT122 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-15558R-BF750 100 µL

IFT122 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
STAG1 Adenovirus (Human)
45666051 1.0 mL

STAG1 Adenovirus (Human)

Sign In for Pricing
View Details
NKX2-8 Protein Vector (Human) (pPB-C-His)
PV104502 500 ng

NKX2-8 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Car13 Mouse shRNA Plasmid (Locus ID 71934)
TL504649 1 Kit

Car13 Mouse shRNA Plasmid (Locus ID 71934)

Sign In for Pricing
View Details
Clusterin His Recombinant Protein
32-1049-20 20 µg

Clusterin His Recombinant Protein

Sign In for Pricing
View Details
Olr624 3'UTR Luciferase Stable Cell Line
TU215350 1.0 mL

Olr624 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details