Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 52K2 (OR52K2)

This Recombinant Human Olfactory receptor 52K2 (OR52K2) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 52K2, Olfactory receptor OR11-7

UniProt

Q8NGK3

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSASNITLTHPTAFLLVGIPGLEHLHIWISIPFCLAYTLALLGNCTLLLIIQADAALHEP MYLFLAMLAAIDLVLSSSALPKMLAIFWFRDREINFFACLAQMFFLHSFSIMESAVLLAM AFDRYVAICKPLHYTKVLTGSLITKIGMAAVARAVTLMTPLPFLLRCFHYCRGPVIAHCY CEHMAVVRLACGDTSFNNIYGIAVAMFIVVLDLLLVILSYIFILQAVLLLASQEARYKAF GTCVSHIGAILAFYTTVVISSVMHRVARHAAPHVHILLANFYLLFPPMVNPIIYGVKTKQ IRESILGVFPRKDM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSPO4 (NM_001029871) Human Over-expression Lysate
LC422255 20 µg

RSPO4 (NM_001029871) Human Over-expression Lysate

Sign In for Pricing
View Details
(1S)-1-[4-(Propan-2-yloxy)phenyl]ethan-1-amine
TRC-S683668-50MG 50 mg

(1S)-1-[4-(Propan-2-yloxy)phenyl]ethan-1-amine

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: bilateral
CR560582 5 µg

Tissue Total RNA, Ovary: bilateral

Sign In for Pricing
View Details
Recombinant UNC13D Antibody
RC-6891-01 50 μL

Recombinant UNC13D Antibody

Sign In for Pricing
View Details
Recombinant UNC13D Antibody
RC-6891-02 100 µL

Recombinant UNC13D Antibody

Sign In for Pricing
View Details
Recombinant UNC13D Antibody
RC-6891-03 1 mL

Recombinant UNC13D Antibody

Sign In for Pricing
View Details