Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 52K2 (OR52K2)

This Recombinant Human Olfactory receptor 52K2 (OR52K2) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 52K2, Olfactory receptor OR11-7

UniProt

Q8NGK3

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSASNITLTHPTAFLLVGIPGLEHLHIWISIPFCLAYTLALLGNCTLLLIIQADAALHEP MYLFLAMLAAIDLVLSSSALPKMLAIFWFRDREINFFACLAQMFFLHSFSIMESAVLLAM AFDRYVAICKPLHYTKVLTGSLITKIGMAAVARAVTLMTPLPFLLRCFHYCRGPVIAHCY CEHMAVVRLACGDTSFNNIYGIAVAMFIVVLDLLLVILSYIFILQAVLLLASQEARYKAF GTCVSHIGAILAFYTTVVISSVMHRVARHAAPHVHILLANFYLLFPPMVNPIIYGVKTKQ IRESILGVFPRKDM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (DF-T1), CF488A conjugate, 0.1mg/mL
BNC880027-500 1x 500 µL

CD43 (DF-T1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 Recombinant Rabbit monoclonal Antibody
HA750069 100 µL

Cytokeratin 18 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Wbp2nl Mouse Gene Knockout Kit (CRISPR)
KN519322 1 Kit

Wbp2nl Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GF-1 Tissue Viral Nucleic Acid Extraction Kit (Proteinase K & Carrier RNA included), 100 preps
GF-TRD-100 100 Preparations

GF-1 Tissue Viral Nucleic Acid Extraction Kit (Proteinase K & Carrier RNA included), 100 preps

Sign In for Pricing
View Details
GALE (Center) Rabbit Polyclonal Antibody
AP17410PU-N 400 µL

GALE (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ALDH3B2 (C-term) Rabbit Polyclonal Antibody
AP50142PU-N 400 µL

ALDH3B2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details