Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5B12 (OR5B12)

This Recombinant Human Olfactory receptor 5B12 (OR5B12) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 5B12, Olfactory receptor 5B16, Olfactory receptor OR11-241

UniProt

Q96R08

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENNTEVTEFILVGLTDDPELQIPLFIVFLFIYLITLVGNLGMIELILLDSCLHTPMYFF LSNLSLVDFGYSSAVTPKVMVGFLTGDKFILYNACATQFFFFVAFITAESFLLASMAYDR YAALCKPLHYTTTMTTNVCACLAIGSYICGFLNASIHTGNTFRLSFCRSNVVEHFFCDAP PLLTLSCSDNYISEMVIFFVVGFNDLFSILVILISYLFIFITIMKMRSPEGRQKAFSTCA SHLTAVSIFYGTGIFMYLRPNSSHFMGTDKMASVFYAIVIPMLNPLVYSLRNKEVKSAFK KTVGKAKASIGFIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ppp1r3e shRNA (UAS) - Lentiviral mouse Ppp1r3e shRNA (UAS, iRFP) (25)
GTR15278366 1 Vial

Lentiviral mouse Ppp1r3e shRNA (UAS) - Lentiviral mouse Ppp1r3e shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
ZNF609 sgRNA CRISPR Lentivector set (Human)
K2719501 3x 1.0 µg

ZNF609 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Pitx1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7038503 1.0 µg DNA

Pitx1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Lentiviral human TUBB1 sgRNA gene knockout kit - Lentiviral human TUBB1 sgRNA gene knockout kit (25)
GTR15356109 1 Vial

Lentiviral human TUBB1 sgRNA gene knockout kit - Lentiviral human TUBB1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Sheep CAP Gly domain containing linker protein 1 (CLIP1) ELISA kit
GTR10420526 96 Well

Sheep CAP Gly domain containing linker protein 1 (CLIP1) ELISA kit

Sign In for Pricing
View Details
Human NT-3 (Neurotrophin-3) ELISA Kit
MBS2507932-01 24 Tests (Limit 1)

Human NT-3 (Neurotrophin-3) ELISA Kit

Sign In for Pricing
View Details