Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5B12 (OR5B12)

This Recombinant Human Olfactory receptor 5B12 (OR5B12) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 5B12, Olfactory receptor 5B16, Olfactory receptor OR11-241

UniProt

Q96R08

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENNTEVTEFILVGLTDDPELQIPLFIVFLFIYLITLVGNLGMIELILLDSCLHTPMYFF LSNLSLVDFGYSSAVTPKVMVGFLTGDKFILYNACATQFFFFVAFITAESFLLASMAYDR YAALCKPLHYTTTMTTNVCACLAIGSYICGFLNASIHTGNTFRLSFCRSNVVEHFFCDAP PLLTLSCSDNYISEMVIFFVVGFNDLFSILVILISYLFIFITIMKMRSPEGRQKAFSTCA SHLTAVSIFYGTGIFMYLRPNSSHFMGTDKMASVFYAIVIPMLNPLVYSLRNKEVKSAFK KTVGKAKASIGFIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chemokine (C-X-C Motif) Receptor 4 (CXCR4) ACTOne Stable Cell Line
MBS433662 Inquire

Chemokine (C-X-C Motif) Receptor 4 (CXCR4) ACTOne Stable Cell Line

Sign In for Pricing
View Details
Plakophilin 1 (PKP1) (NM_000299) Human Tagged ORF Clone Lentiviral Particle
RC217943L3V 200 µL

Plakophilin 1 (PKP1) (NM_000299) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CD62L Antibody
orb2669481 100 Tests

CD62L Antibody

Sign In for Pricing
View Details
EXOC4 sgRNA CRISPR Lentivector (Human) (Target 1)
K0702602 1.0 µg DNA

EXOC4 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CGI-143 Rabbit Polyclonal Antibody
orb324400 100 µL

CGI-143 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human NMU shRNA (UAS) - Lentiviral human NMU shRNA (UAS, RFP) (100)
GTR15106692 1 Vial

Lentiviral human NMU shRNA (UAS) - Lentiviral human NMU shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details