Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 9Q2 (OR9Q2)

This Recombinant Human Olfactory receptor 9Q2 (OR9Q2) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 9Q2

UniProt

Q8NGE9

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAERNYTVVTEFFLTAFTEHLQWRVPLFLIFLSFYLATMLGNTGMILLIRGDRRLHTPMY FFLSHLSLVDICYSSAIIPQMLAVLWEHGTTISQARCAAQFFLFTFFASIDCYLLAIMAY DRYTAVCQPLLYVTIITEKARWGLVTGAYVAGFFSAFVRTVTAFTLSFCGNNEINFIFCD LPPLLKLSCGDSYTQEVVIIVFALFVMPACILVILVSYLFIIVAILQIHSAGGRAKTFST CASHLTAVALFFGTLIFMYLRDNTGQSSEGDRVVSVLYTVVTPMLNPLIYSLRNKEVKEA TRKALSKSKPARRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Gamma-aminobutyric acid, GABA ELISA Kit
YLA0327RA-01 48 Tests

Rat Gamma-aminobutyric acid, GABA ELISA Kit

Sign In for Pricing
View Details
Rat Gamma-aminobutyric acid, GABA ELISA Kit
YLA0327RA-02 96 Tests

Rat Gamma-aminobutyric acid, GABA ELISA Kit

Sign In for Pricing
View Details
HSF2 discontinued
390169 200 µL

HSF2 discontinued

Sign In for Pricing
View Details
Lentiviral mouse Psma1 shRNA (UAS) - Lentiviral mouse Psma1 shRNA (UAS, iRFP) (100)
GTR15300798 1 Vial

Lentiviral mouse Psma1 shRNA (UAS) - Lentiviral mouse Psma1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
GFP hsa-miR-7846-3p AAV miRNA Vector
Amh1271500 500 ng

GFP hsa-miR-7846-3p AAV miRNA Vector

Sign In for Pricing
View Details
AP-4 complex subunit mu-1 (AP4M1) Bovine ELISA Kit
B5935 96 Tests

AP-4 complex subunit mu-1 (AP4M1) Bovine ELISA Kit

Sign In for Pricing
View Details