Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 9Q2 (OR9Q2)

This Recombinant Human Olfactory receptor 9Q2 (OR9Q2) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 9Q2

UniProt

Q8NGE9

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAERNYTVVTEFFLTAFTEHLQWRVPLFLIFLSFYLATMLGNTGMILLIRGDRRLHTPMY FFLSHLSLVDICYSSAIIPQMLAVLWEHGTTISQARCAAQFFLFTFFASIDCYLLAIMAY DRYTAVCQPLLYVTIITEKARWGLVTGAYVAGFFSAFVRTVTAFTLSFCGNNEINFIFCD LPPLLKLSCGDSYTQEVVIIVFALFVMPACILVILVSYLFIIVAILQIHSAGGRAKTFST CASHLTAVALFFGTLIFMYLRDNTGQSSEGDRVVSVLYTVVTPMLNPLIYSLRNKEVKEA TRKALSKSKPARRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP4B1 (AP-4 Complex Subunit beta-1, AP-4 Adapter Complex Subunit beta, Adapter-related Protein Complex 4 Subunit beta-1, Beta Subunit of AP-4, Beta4-adaptin) (Biotin)
123383-Biotin 100 µL

AP4B1 (AP-4 Complex Subunit beta-1, AP-4 Adapter Complex Subunit beta, Adapter-related Protein Complex 4 Subunit beta-1, Beta Subunit of AP-4, Beta4-adaptin) (Biotin)

Sign In for Pricing
View Details
SPC25 3'UTR GFP Stable Cell Line
TU074428 1.0 mL

SPC25 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rbmx2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3592304 1.0 µg DNA

Rbmx2 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
DENND4B Rabbit pAb, PE-Cy5 conjugated
orb2840108 100 µL

DENND4B Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
XTP3TPA Antibody, Rabbit PAb, Antigen Affinity Purified
MBS8124392-01 0.1 mL

XTP3TPA Antibody, Rabbit PAb, Antigen Affinity Purified

Sign In for Pricing
View Details
XTP3TPA Antibody, Rabbit PAb, Antigen Affinity Purified
MBS8124392-02 5x 0.1 mL

XTP3TPA Antibody, Rabbit PAb, Antigen Affinity Purified

Sign In for Pricing
View Details