Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 494 (Olfr494)

This Recombinant Mouse Olfactory receptor 494 (Olfr494) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 494, Olfactory receptor 204-10

UniProt

Q8VG07

Expression Region

1-314

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLQDGNHTAVTEFILLGLTDGPILRVILFTIILCIYLVTVSGNLSTILLIRVSSQLHH PMYFFLSHLASVDMGLSSSVTPNMLVNFLVKQNTISYIACSIQFGLAAFFGTVECFLLAA MAYDRFVAICNPLLYSTKISTESCIQLVVGSYIGGFLNASSFILSFFSFIFCGPNRINHF YCDLAPLVELSCSDVSVSVVVTSFSAGSVTVITVFVIAVSYSYILITILKMHSTEGRHKA FSTCTSHLTAVTLYYGTITFIYVMPKSSYSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEI KGAIKRQLGKKMFC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ELMO1 Antibody
RC-15110-01 50 μL

Recombinant ELMO1 Antibody

Sign In for Pricing
View Details
Recombinant ELMO1 Antibody
RC-15110-02 100 µL

Recombinant ELMO1 Antibody

Sign In for Pricing
View Details
Recombinant ELMO1 Antibody
RC-15110-03 1 mL

Recombinant ELMO1 Antibody

Sign In for Pricing
View Details
alpha Synuclein (SNCA) Goat Polyclonal Antibody
AP32035PU-N 100 µg

alpha Synuclein (SNCA) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Polystyrene M RAM
HAM2023.5G 5 g

Polystyrene M RAM

Sign In for Pricing
View Details
Helicobacter pylori (HP/1335), Biotin conjugate, 0.1mg/mL
BNCB1335-100 1x 100 µL

Helicobacter pylori (HP/1335), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details