Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 494 (Olfr494)

This Recombinant Mouse Olfactory receptor 494 (Olfr494) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 494, Olfactory receptor 204-10

UniProt

Q8VG07

Expression Region

1-314

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLQDGNHTAVTEFILLGLTDGPILRVILFTIILCIYLVTVSGNLSTILLIRVSSQLHH PMYFFLSHLASVDMGLSSSVTPNMLVNFLVKQNTISYIACSIQFGLAAFFGTVECFLLAA MAYDRFVAICNPLLYSTKISTESCIQLVVGSYIGGFLNASSFILSFFSFIFCGPNRINHF YCDLAPLVELSCSDVSVSVVVTSFSAGSVTVITVFVIAVSYSYILITILKMHSTEGRHKA FSTCTSHLTAVTLYYGTITFIYVMPKSSYSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEI KGAIKRQLGKKMFC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GMPR1 (GMPR) activation kit by CRISPRa
GA101840 1 Kit

Human GMPR1 (GMPR) activation kit by CRISPRa

Sign In for Pricing
View Details
ALDH1A1 Mouse Monoclonal Antibody [8F1]
EM1801-07 100 µL

ALDH1A1 Mouse Monoclonal Antibody [8F1]

Sign In for Pricing
View Details
2-Bromo-D-lysergic Acid Diethylamide
TRC-B478840-50MG 50 mg

2-Bromo-D-lysergic Acid Diethylamide

Sign In for Pricing
View Details
RK 33
TRC-R545500-2.5MG 2.5 mg

RK 33

Sign In for Pricing
View Details
NFKB1 Rabbit Polyclonal Antibody
TA379088 100 µL

NFKB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ABHD11 activation kit by CRISPRa
GA113175 1 Kit

Human ABHD11 activation kit by CRISPRa

Sign In for Pricing
View Details