Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 490 (Olfr490)

This Recombinant Mouse Olfactory receptor 490 (Olfr490) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 490, Olfactory receptor 204-17

UniProt

Q8VFD2

Expression Region

1-314

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLENGNHTAVSEFILLGLTDDPVLRIVLFTIILCIYLVTVSGNLSTILLIRVSSQLHH PMYFFLSHLASADIGLSSSVTPNMLVNFLVERSTISYLGCGIQLSSAALFGATECFLLAA MAYDRFMAICNPLLYSTKMSTKVCVQLIVGSYIAGFLNASSFLLSFFSLLFCGQNIINDF FCDFAPLAELSCSDVSVFVVVISFSAGTVTMLTVFVIAISYSYILITILKMRSTEGRQKA FSTCTSHLTAVTLFYGTVTFIYVMPKSSYSMDQNKIISVFYMVVVPMLNPLIYSLRNNEI KGALKRHFDRKTFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cynomolgus Monkey ARoom Temperatureery Smooth Muscle Cells
NHP-PC149 Each

Cynomolgus Monkey ARoom Temperatureery Smooth Muscle Cells

Sign In for Pricing
View Details
Goat Polyclonal Bim Antibody
NB100-1440 0.1 mg

Goat Polyclonal Bim Antibody

Sign In for Pricing
View Details
PPIL1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV628022 1.0 µg DNA

PPIL1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Vom1r17 Protein Vector (Rat) (pPM-C-His)
PV315329 500 ng

Vom1r17 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
TIMM9 Polyclonal Antibody, FITC Conjugated
A61320-050 50 µL

TIMM9 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
MRX74 Protein Vector (Human) (pPB-N-His)
PV101555 500 ng

MRX74 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details