Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 490 (Olfr490)

This Recombinant Mouse Olfactory receptor 490 (Olfr490) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 490, Olfactory receptor 204-17

UniProt

Q8VFD2

Expression Region

1-314

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLENGNHTAVSEFILLGLTDDPVLRIVLFTIILCIYLVTVSGNLSTILLIRVSSQLHH PMYFFLSHLASADIGLSSSVTPNMLVNFLVERSTISYLGCGIQLSSAALFGATECFLLAA MAYDRFMAICNPLLYSTKMSTKVCVQLIVGSYIAGFLNASSFLLSFFSLLFCGQNIINDF FCDFAPLAELSCSDVSVFVVVISFSAGTVTMLTVFVIAISYSYILITILKMRSTEGRQKA FSTCTSHLTAVTLFYGTVTFIYVMPKSSYSMDQNKIISVFYMVVVPMLNPLIYSLRNNEI KGALKRHFDRKTFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OOCA01743-25T - Human TP53I3 Primer Pair 1
OOCA01743-25T 25 Tests

OOCA01743-25T - Human TP53I3 Primer Pair 1

Sign In for Pricing
View Details
Mouse CD1 Heart, left and right atrium cDNA-Random Primer
MD-802-HR 30 Reactions

Mouse CD1 Heart, left and right atrium cDNA-Random Primer

Sign In for Pricing
View Details
Human sE-Selectin ELISA Kit
EK184-01 48 Tests

Human sE-Selectin ELISA Kit

Sign In for Pricing
View Details
Human sE-Selectin ELISA Kit
EK184-02 96 Tests

Human sE-Selectin ELISA Kit

Sign In for Pricing
View Details
Human HDAC1 qPCR Primer Pair
QH03305S 200 Tests

Human HDAC1 qPCR Primer Pair

Sign In for Pricing
View Details
Human OLR1 knockdown cell line
ABC-KD10532 1 Vial

Human OLR1 knockdown cell line

Sign In for Pricing
View Details