Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 497 (Olfr497)

This Recombinant Mouse Olfactory receptor 497 (Olfr497) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 497, Olfactory receptor 204-9

UniProt

Q8VG08

Expression Region

1-314

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLEVGNHTAVTEFILLGLTDDPVLRVVLFTIILCIYLVTVMGNLSTILLIRVSSQLHH PMYFFLSHLASVDMGLSSSVTPNMLLNFLIERNTISYLGCGIQQSLADFFGSVECFLLAA MAYDRFMAICNPLLYSTKMSTKVCVQLVVGSYIGGFLNASLIMFYFFSFLFCGPNRVDHF FCDFAPLVELSCSDVSVSVIVISFSAGSVTMITVFVIAVSYSYILITILKMHSIEGRHKA FSTCTSHLTAVTLYYGTITFIYVMPKSSFSTDQNKVVSVFYMVMIPMLNPLIYSLRNNEI KGAIKRQLGKKMSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Lactose ELISA Kit
OM624392 96 Strip Well

Bovine Lactose ELISA Kit

Sign In for Pricing
View Details
Pyruvate Kinase Microplate Assay Kit
MBS4504394-01 100 Assays

Pyruvate Kinase Microplate Assay Kit

Sign In for Pricing
View Details
Pyruvate Kinase Microplate Assay Kit
MBS4504394-02 5x 100 Assays

Pyruvate Kinase Microplate Assay Kit

Sign In for Pricing
View Details
Pyruvate Kinase Microplate Assay Kit
MBS4504394-03 10x 100 Assays

Pyruvate Kinase Microplate Assay Kit

Sign In for Pricing
View Details
GSPT2 Peptide - middle region
MBS3237127-01 0.1 mg

GSPT2 Peptide - middle region

Sign In for Pricing
View Details
GSPT2 Peptide - middle region
MBS3237127-02 5x 0.1 mg

GSPT2 Peptide - middle region

Sign In for Pricing
View Details