Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 497 (Olfr497)

This Recombinant Mouse Olfactory receptor 497 (Olfr497) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 497, Olfactory receptor 204-9

UniProt

Q8VG08

Expression Region

1-314

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLEVGNHTAVTEFILLGLTDDPVLRVVLFTIILCIYLVTVMGNLSTILLIRVSSQLHH PMYFFLSHLASVDMGLSSSVTPNMLLNFLIERNTISYLGCGIQQSLADFFGSVECFLLAA MAYDRFMAICNPLLYSTKMSTKVCVQLVVGSYIGGFLNASLIMFYFFSFLFCGPNRVDHF FCDFAPLVELSCSDVSVSVIVISFSAGSVTMITVFVIAVSYSYILITILKMHSIEGRHKA FSTCTSHLTAVTLYYGTITFIYVMPKSSFSTDQNKVVSVFYMVMIPMLNPLIYSLRNNEI KGAIKRQLGKKMSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAZAP2 (DAZ Associated Protein 2, KIAA0058, MGC14319, MGC766, PRTB) (MaxLight 405)
MBS6195156-01 0.1 mL

DAZAP2 (DAZ Associated Protein 2, KIAA0058, MGC14319, MGC766, PRTB) (MaxLight 405)

Sign In for Pricing
View Details
DAZAP2 (DAZ Associated Protein 2, KIAA0058, MGC14319, MGC766, PRTB) (MaxLight 405)
MBS6195156-02 5x 0.1 mL

DAZAP2 (DAZ Associated Protein 2, KIAA0058, MGC14319, MGC766, PRTB) (MaxLight 405)

Sign In for Pricing
View Details
IL16 ELISA Kit (Monkey) (OKWB00302)
OKWB00302 96 Well

IL16 ELISA Kit (Monkey) (OKWB00302)

Sign In for Pricing
View Details
Mouse Monoclonal CD90/Thy1 Antibody (OX-7) [Janelia Fluor 525]
NB100-65543JF525 0.25 mL

Mouse Monoclonal CD90/Thy1 Antibody (OX-7) [Janelia Fluor 525]

Sign In for Pricing
View Details
Anti-DHODH Antibody Picoband® (Dylight488 Conjugate)
PB10056-Dylight488 100 µg

Anti-DHODH Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
S100A12 Antibody, Biotin conjugated
A76757-50UL 50 μL

S100A12 Antibody, Biotin conjugated

Sign In for Pricing
View Details