Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 497 (Olfr497)

This Recombinant Mouse Olfactory receptor 497 (Olfr497) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 497, Olfactory receptor 204-9

UniProt

Q8VG08

Expression Region

1-314

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLEVGNHTAVTEFILLGLTDDPVLRVVLFTIILCIYLVTVMGNLSTILLIRVSSQLHH PMYFFLSHLASVDMGLSSSVTPNMLLNFLIERNTISYLGCGIQQSLADFFGSVECFLLAA MAYDRFMAICNPLLYSTKMSTKVCVQLVVGSYIGGFLNASLIMFYFFSFLFCGPNRVDHF FCDFAPLVELSCSDVSVSVIVISFSAGSVTMITVFVIAVSYSYILITILKMHSIEGRHKA FSTCTSHLTAVTLYYGTITFIYVMPKSSFSTDQNKVVSVFYMVMIPMLNPLIYSLRNNEI KGAIKRQLGKKMSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabies (Rabies Virus) (FITC)
R0011-01A-FITC 100 µL

Rabies (Rabies Virus) (FITC)

Sign In for Pricing
View Details
Crystal Ponceau 6R
orb2566587-01 50 mg

Crystal Ponceau 6R

Sign In for Pricing
View Details
Crystal Ponceau 6R
orb2566587-02 10 mg

Crystal Ponceau 6R

Sign In for Pricing
View Details
Mouse Monoclonal ATRIP Antibody (OTI1G6) [Allophycocyanin]
NBP2-72270APC 0.1 mL

Mouse Monoclonal ATRIP Antibody (OTI1G6) [Allophycocyanin]

Sign In for Pricing
View Details
NNMT, ID (NNMT, Nicotinamide N-methyltransferase) (AP) discontinued
039036-AP 200 µL

NNMT, ID (NNMT, Nicotinamide N-methyltransferase) (AP) discontinued

Sign In for Pricing
View Details
PRMT7 Antibody
orb1328174 100 µg

PRMT7 Antibody

Sign In for Pricing
View Details