Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5B17 (OR5B17)

This Recombinant Human Olfactory receptor 5B17 (OR5B17) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 5B17, Olfactory receptor 5B20, Olfactory receptor OR11-237

UniProt

Q8NGF7

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENNTEVSEFILLGLTNAPELQVPLFIMFTLIYLITLTGNLGMIILILLDSHLHTPMYFF LSNLSLAGIGYSSAVTPKVLTGLLIEDKAISYSACAAQMFFCAVFATVENYLLSSMAYDR YAAVCNPLHYTTTMTTRVCACLAIGCYVIGFLNASIQIGDTFRLSFCMSNVIHHFFCDKP AVITLTCSEKHISELILVLISSFNVFFALLVTLISYLFILITILKRHTGKGYQKPLSTCG SHLIAIFLFYITVIIMYIRPSSSHSMDTDKIASVFYTMIIPMLSPIVYTLRNKDVKNAFM KVVEKAKYSLDSVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL12P27 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1904107 1.0 µg DNA

RPL12P27 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
ZNF444 (Zinc Finger Protein 444, Endothelial Zinc Finger Protein 2, EZF2, EZF-2, Zinc Finger and SCAN Domain-containing Protein 17, ZSCAN17) (MaxLight 405) discontinued
135739-ML405 100 µL

ZNF444 (Zinc Finger Protein 444, Endothelial Zinc Finger Protein 2, EZF2, EZF-2, Zinc Finger and SCAN Domain-containing Protein 17, ZSCAN17) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Goat Polyclonal Albumin Antibody [Janelia Fluor 585]
NB600-41532JF585 1 mL

Goat Polyclonal Albumin Antibody [Janelia Fluor 585]

Sign In for Pricing
View Details
Guinea Pig microtubule-actin crosslinking factor 1 ELISA Kit
MBS7270613-01 48 Well

Guinea Pig microtubule-actin crosslinking factor 1 ELISA Kit

Sign In for Pricing
View Details
Guinea Pig microtubule-actin crosslinking factor 1 ELISA Kit
MBS7270613-02 96 Well

Guinea Pig microtubule-actin crosslinking factor 1 ELISA Kit

Sign In for Pricing
View Details
Guinea Pig microtubule-actin crosslinking factor 1 ELISA Kit
MBS7270613-03 5x 96 Well

Guinea Pig microtubule-actin crosslinking factor 1 ELISA Kit

Sign In for Pricing
View Details