Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 469 (Olfr469)

This Recombinant Mouse Olfactory receptor 469 (Olfr469) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 469, Olfactory receptor 204-21

UniProt

Q8VF66

Expression Region

1-314

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLEDANHTAVTEFILLGLTDDPVLKVVLFSIILCIYLVTVSGNLSTILLIRVSSQLHH PMYFFLSHLASVDVGYSSTVTPKMLANFLVERSTISYLGCTIQLFSGAFFGTLECFLLAT MAYDRFIAICNPLLYSTKMSTQVCIQLLVGSYIGGFLNASSFLLSFFPLLFCGPNRVNHF FCDLAPLIELSCSGSNVPIVPASFCSAFVIIVTVFVIAISYTYILITILKMRSTEGRQKA FSTCTSHLTAVTLFYGTITFIYVMPKSSFSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEI KGALKRQLARKIFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DACH1 (NM_080759) Human Over-expression Lysate
LS001602 100 µg

DACH1 (NM_080759) Human Over-expression Lysate

Sign In for Pricing
View Details
PLEKHG4 Polyclonal Conjugated Antibody
MBS9440906-01 0.1 mL (Biotin)

PLEKHG4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
PLEKHG4 Polyclonal Conjugated Antibody
MBS9440906-02 0.1 mL (AF350)

PLEKHG4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
PLEKHG4 Polyclonal Conjugated Antibody
MBS9440906-03 0.1 mL (AF405)

PLEKHG4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
PLEKHG4 Polyclonal Conjugated Antibody
MBS9440906-04 0.1 mL (AF488)

PLEKHG4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
PLEKHG4 Polyclonal Conjugated Antibody
MBS9440906-05 0.1 mL (AF555)

PLEKHG4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details